Protein Info for DvMF_0341 in Desulfovibrio vulgaris Miyazaki F

Annotation: glycine cleavage system T protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 TIGR00528: glycine cleavage system T protein" amino acids 5 to 335 (331 residues), 276.7 bits, see alignment E=1.3e-86 PF01571: GCV_T" amino acids 9 to 255 (247 residues), 300 bits, see alignment E=1.3e-93 PF08669: GCV_T_C" amino acids 277 to 352 (76 residues), 50 bits, see alignment E=2.3e-17

Best Hits

Swiss-Prot: 46% identical to GCST_SYNPX: Aminomethyltransferase (gcvT) from Synechococcus sp. (strain WH8102)

KEGG orthology group: K00605, aminomethyltransferase [EC: 2.1.2.10] (inferred from 100% identity to dvm:DvMF_0341)

Predicted SEED Role

"Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 2.1.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DPL1 at UniProt or InterPro

Protein Sequence (362 amino acids)

>DvMF_0341 glycine cleavage system T protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSDLLQTPLSAWHRAAGAKMAPFAGWDMPIQYPTGIIAEHVQTRESAALFDICHMGEFTL
RGPGARDALSRAVSHNLETLKPGRCRYGFLLNEAGGILDDLIVYCVAEDDYMLVVNGACT
ESDFAALRSRLPAVLPFEDISARTAKLDLQGPKSFDVLEAVLGESFRDLPYFGFRSVVFG
GAPLLVSRTGYTGELGVELYLPWDKAEALWTALLADERVKPAGLGARDTLRLEVGLPLYG
HDLDDTHTPAEAGYGGMLTNPADYVGKGADREVREPLVALSIPGRRSARHGDVVALPDGT
VAGVVTSGSFCPSLGYAVALARVAAAHAEAPTFVVKAAKVELEATRVALPFYTQGTARTK
LI