Protein Info for DvMF_0334 in Desulfovibrio vulgaris Miyazaki F

Annotation: Glutamate--tRNA ligase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 18 to 35 (18 residues), see Phobius details amino acids 302 to 319 (18 residues), see Phobius details PF00749: tRNA-synt_1c" amino acids 5 to 323 (319 residues), 187.1 bits, see alignment E=2e-59

Best Hits

KEGG orthology group: K01885, glutamyl-tRNA synthetase [EC: 6.1.1.17] (inferred from 100% identity to dvm:DvMF_0334)

Predicted SEED Role

"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.17

Use Curated BLAST to search for 6.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DPK4 at UniProt or InterPro

Protein Sequence (373 amino acids)

>DvMF_0334 Glutamate--tRNA ligase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSRPVRGRLAPSPTGHIHLGNAASFLMAWLCARAAGGQMVLRMEDIDPDRSRPEFVADMV
RDLLWLGLDWDEGPEFPDMLADPQPDPRPDGASAPVSTPPLGLCAVPDHARMPGRGGPHG
PYSQSERLALYADALARLEREGHVYPCFCTRKELRSLASAPHAGECGPAYPGTCRNLGPE
DRARRLAEGRRPAMRVRCDDTAIAFTDHIAGPQRMSLAECGGDFAVRRSDGVFAYQLAVV
VDDIAMGITQVVRGDDILASTPRQIWLYRLLGAPVPEYVHVPLLLDHEGERLAKRHGSLT
VAALRSAGVSPWAIVGYLAWRLGLRDAPGLVVPRELAGTLDLARVVRQPVMLPEDVPDVL
RRMGQGATEGDWR