Protein Info for DvMF_0331 in Desulfovibrio vulgaris Miyazaki F

Annotation: PAS/PAC sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF13188: PAS_8" amino acids 45 to 98 (54 residues), 22 bits, see alignment 2.9e-08 TIGR00229: PAS domain S-box protein" amino acids 47 to 160 (114 residues), 24.9 bits, see alignment E=9.3e-10 PF08448: PAS_4" amino acids 49 to 155 (107 residues), 30.1 bits, see alignment E=1.2e-10 PF13426: PAS_9" amino acids 56 to 152 (97 residues), 31.2 bits, see alignment E=5.6e-11 PF00512: HisKA" amino acids 172 to 242 (71 residues), 44.1 bits, see alignment E=4.3e-15 PF02518: HATPase_c" amino acids 291 to 439 (149 residues), 79.3 bits, see alignment E=7.6e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0331)

Predicted SEED Role

"histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DPK1 at UniProt or InterPro

Protein Sequence (441 amino acids)

>DvMF_0331 PAS/PAC sensor signal transduction histidine kinase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTQGTSLDDLIGIEHSKLGFFQELRQTIEQLKAAHRDSERNRLEIEAILDGITDLMMVLS
KDLRIIAVNHVFYDILGVRDPEGRYCYEIFRQQDHPCPECPAHRSFVTDEVCRETSIFRI
NGRKLQFEMVASPIKDPATQDRQILIFKRDVTLEKEFQAKFHQAEKMATVGMLAAGVAHE
VNNPLTAIHGFAEGILRRVERLRGIVDPEMHADLADYAGTILGECGRCQEIVHSLLTFSR
PHSSEFSPVNLNVVVGDTLKLLHNHLKQPKYRRVRIDARLCPTAPVVLACEAQLKQVMLN
LLVNALDAFDGPAGPEGKGQASPPRADAGSADGNAAGGDEELSTVNGGRGRNGVEEVITV
TPFRDGRHAGFVVHDTGSGIPPEHLDSLFEPFFTTKPVGRGIGIGLSTCYTIVTEHGGDI
RVESRVGEGSTFTVTLPLPPE