Protein Info for DvMF_0280 in Desulfovibrio vulgaris Miyazaki F

Annotation: holo-acyl-carrier-protein synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00556: phosphopantetheine--protein transferase domain
  • amino acids 1 to 123 (123 residues), 93.9 bits, E=7.9e-31
• TIGR00516: holo-[acyl-carrier-protein] synthase
  • amino acids 1 to 123 (123 residues), 101.5 bits, E=4e-33
• PF01648: ACPS
  • amino acids 4 to 101 (98 residues), 74.5 bits, E=3.4e-25

Best Hits

Swiss-Prot: 100% identical to ACPS_DESVM: Holo-[acyl-carrier-protein] synthase (acpS) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K00997, holo-[acyl-carrier protein] synthase [EC: 2.7.8.7] (inferred from 100% identity to dvm:DvMF_0280)

Predicted SEED Role

"Holo-[acyl-carrier protein] synthase (EC 2.7.8.7)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.7.8.7)

MetaCyc Pathways

• acyl carrier protein activation (1/1 steps found)
• acyl carrier protein metabolism (1/2 steps found)
• enterobactin biosynthesis (4/11 steps found)
• petrobactin biosynthesis (1/10 steps found)
• superpathway of chorismate metabolism (31/59 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.7

Sequence Analysis Tools

See B8DPF0 at UniProt or InterPro

Protein Sequence (123 amino acids)

>DvMF_0280 holo-acyl-carrier-protein synthase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MIVGLGIDIAELSRIARAWERHGRRFAARVLHPAELACLPAAPVAFLAARFAAKEAAVKA
LGTGFSQGIGPRDIEVRPLPTGQPQLVLHGKAAARCAALGATATHVSLTHGRDTAAAVVV
LER