Protein Info for DvMF_0243 in Desulfovibrio vulgaris Miyazaki F

Name: rnc
Annotation: ribonuclease III (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 TIGR02191: ribonuclease III" amino acids 6 to 224 (219 residues), 240 bits, see alignment E=1.1e-75 PF14622: Ribonucleas_3_3" amino acids 16 to 142 (127 residues), 143.1 bits, see alignment E=8.5e-46 PF00636: Ribonuclease_3" amino acids 40 to 130 (91 residues), 95.7 bits, see alignment E=3.9e-31 PF00035: dsrm" amino acids 158 to 224 (67 residues), 43.3 bits, see alignment E=6.7e-15

Best Hits

Swiss-Prot: 100% identical to RNC_DESVM: Ribonuclease 3 (rnc) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 100% identity to dvm:DvMF_0243)

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DPB3 at UniProt or InterPro

Protein Sequence (230 amino acids)

>DvMF_0243 ribonuclease III (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MFEKLQSDIHYAFNDAGLLATAMTHSSWANEQQEHVEHNERLEFLGDAVLELCVSEELFA
RFPGAREGDLTRMRARLVSKPALAELARDLQLELYLRLGRGEESQGGRERSSLLSDALEA
MLGAVFLDGGYERARAVVRHVLAARWPCDADGKRSKDYKSRLQELTQSLFRERPVYALMG
SSGPEHEKRFEVRLTLPDGTVFTAIGPSVKRAEQMAAGLALKNLESRSDG