Protein Info for DvMF_0185 in Desulfovibrio vulgaris Miyazaki F

Annotation: pyruvate ferredoxin/flavodoxin oxidoreductase, beta subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02177: 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family
  • amino acids 13 to 252 (240 residues), 333.9 bits, E=4.6e-104
• PF02775: TPP_enzyme_C
  • amino acids 51 to 193 (143 residues), 98.5 bits, E=3.4e-32
• PF12367: PFO_beta_C
  • amino acids 198 to 261 (64 residues), 94.1 bits, E=4.4e-31

Best Hits

Swiss-Prot: 45% identical to OFOB_SACSO: 2-oxoacid:ferredoxin oxidoreductase subunit beta (SSOP1_2914) from Saccharolobus solfataricus

KEGG orthology group: K00175, 2-oxoglutarate ferredoxin oxidoreductase subunit beta [EC: 1.2.7.3] (inferred from 100% identity to dvm:DvMF_0185)

MetaCyc: 43% identical to 2-oxoglutarate--ferredoxin oxidoreductase beta subunit (Halobacterium salinarum)
2-oxoglutarate synthase. [EC: 1.2.7.3]

Predicted SEED Role

"2-oxoglutarate oxidoreductase, beta subunit (EC 1.2.7.3)" (EC 1.2.7.3)

MetaCyc Pathways

• reductive TCA cycle I (9/11 steps found)
• incomplete reductive TCA cycle (6/7 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• TCA cycle VI (Helicobacter) (7/9 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• reductive TCA cycle II (7/12 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Citrate cycle (TCA cycle)
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.3

Use Curated BLAST to search for 1.2.7.3

Sequence Analysis Tools

See B8DNT8 at UniProt or InterPro

Protein Sequence (283 amino acids)

>DvMF_0185 pyruvate ferredoxin/flavodoxin oxidoreductase, beta subunit (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MDIEVYGEYKKTAWCPGCGNHDVMKAVRQALAGLDLAPNRVAHVSGIGQAAKAPHYIDLN
GFNGLHGRGLPPAQAIKLCNPELTVIAQSGDGCNYGEGGNHFLAAIRRNVDMTLLVHDNQ
IYGLTKGQASPTTPEGQITKSQPDGVRNAPFNPIAVAVAMKCSFVARSFSGNTPHLVKMI
QLAIQHKGFALVDLFSPCVSFNKVNTFGWYKQRCQELPEDYDPTDWAAAMQVAQEFGERI
PIGVIYRNDRPSLDASLPVLQKGPLGRQPVDRDGLRALMQSYT