Protein Info for DvMF_0151 in Desulfovibrio vulgaris Miyazaki F

Annotation: protein of unknown function DUF167 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 PF02594: DUF167" amino acids 21 to 91 (71 residues), 75.7 bits, see alignment E=1.3e-25

Best Hits

Swiss-Prot: 38% identical to Y3464_AZOSB: UPF0235 protein azo3464 (azo3464) from Azoarcus sp. (strain BH72)

KEGG orthology group: K09131, hypothetical protein (inferred from 100% identity to dvm:DvMF_0151)

Predicted SEED Role

"COG1872"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DNQ5 at UniProt or InterPro

Protein Sequence (106 amino acids)

>DvMF_0151 protein of unknown function DUF167 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MGLPDSARPEWAAPAGEGQWAVLVRAVPGARKSACEGTADGRLKVRLAAPAVDNKANKAL
EEFVASALGMRRNRVRLVSGHTSRLKKLIVESDVEPSWGLLGTCGK