Protein Info for DvMF_0129 in Desulfovibrio vulgaris Miyazaki F

Annotation: 6-pyruvoyl tetrahydropterin synthase and hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF01242: PTPS" amino acids 8 to 126 (119 residues), 131.2 bits, see alignment E=9.8e-43 TIGR03367: queuosine biosynthesis protein QueD" amino acids 8 to 100 (93 residues), 89.7 bits, see alignment E=6.5e-30

Best Hits

KEGG orthology group: K01737, 6-pyruvoyl tetrahydrobiopterin synthase [EC: 4.2.3.12] (inferred from 100% identity to dvm:DvMF_0129)

Predicted SEED Role

"6-pyruvoyl tetrahydropterin synthase and hypothetical protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.3.12

Use Curated BLAST to search for 4.2.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DNN3 at UniProt or InterPro

Protein Sequence (130 amino acids)

>DvMF_0129 6-pyruvoyl tetrahydropterin synthase and hypothetical protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MKKSIWRLTVRSEFCASHALRHYEGKCESMHGHNFAVEMVAEGDRLTGDTEIVLDFKVLK
RELNAVLDTLDHKNLNDVTPFDTINPSSENLSRHIWQQLAPRLAPHGVRLHSVTVSEKAA
QSATYMEIDE