Protein Info for DvMF_0117 in Desulfovibrio vulgaris Miyazaki F

Annotation: ABC-3 protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 57 to 57 (1 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 176 to 203 (28 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details PF00950: ABC-3" amino acids 6 to 259 (254 residues), 218.5 bits, see alignment E=6e-69

Best Hits

Swiss-Prot: 49% identical to Y2045_SYNY3: Uncharacterized membrane protein slr2045 (slr2045) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K09816, zinc transport system permease protein (inferred from 100% identity to dvm:DvMF_0117)

Predicted SEED Role

"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DNM1 at UniProt or InterPro

Protein Sequence (276 amino acids)

>DvMF_0117 ABC-3 protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MLDALSYDFMQQALAASLLASIACGVIGTLVVVNRLVFLAGGVSHAAYGGVGLAFHYGWP
VLPSAIGFSVASSMLMAGVALKRPEKADTAIGVLWAAGMAFGIILIDLTPGYKADLMSFL
FGSILAVPLTDLYLMAALDAVLLAVVALCHQTLLVASFDREFAEARGLPVRTAHYLVVGM
TAVGVVMLIRVVGLVLVMALLTIPPFIAARSARSLPSMMAAATAWSSVFCVGGLALAYRW
DVTSGAAIIAVASAGFMAVSGVGMLRRAMGKQSISR