Protein Info for DvMF_0107 in Desulfovibrio vulgaris Miyazaki F

Annotation: selenide, water dikinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 TIGR00476: selenide, water dikinase" amino acids 6 to 316 (311 residues), 361.5 bits, see alignment E=1.8e-112 PF00586: AIRS" amino acids 49 to 156 (108 residues), 100 bits, see alignment E=1.1e-32 PF02769: AIRS_C" amino acids 168 to 339 (172 residues), 55.2 bits, see alignment E=9.6e-19

Best Hits

Swiss-Prot: 100% identical to SELD_DESVM: Selenide, water dikinase (selD) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K01008, selenide, water dikinase [EC: 2.7.9.3] (inferred from 100% identity to dvm:DvMF_0107)

Predicted SEED Role

"Selenide,water dikinase (EC 2.7.9.3); selenocysteine-containing" (EC 2.7.9.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.9.3

Use Curated BLAST to search for 2.7.9.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DNL1 at UniProt or InterPro

Protein Sequence (350 amino acids)

>DvMF_0107 selenide, water dikinase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSRIRLVDSVKAAGUAAKVAPGDLERILAGLPRDPSVEDRVIVGTRHNEDAAVVRLPGGQ
SIVQTLDFFTPIVNDPYHFGRIAAANALSDVYAMGGEPWCAMNIVCFPVKRLPESILADI
LRGGSDALREAGAALVGGHSVEDDELKYGLSVTGLIDPEIIASNAGLRPGDHLLLTKPLG
TGILATAVKANWPGCDAHEEELFRWASRLNKGAGRVIRELRLKAATDVTGFGLGGHCLEM
AGASGVTVALDTAALPVLPGVTELAGMGLVPEGSHANRAHCHKHVHVAPGVSPVLVDVAF
DAQTSGGMLLAVSPDQMDAATTLLAETGDPAYPVGEVLKPLPGGVRLLLR