Protein Info for DvMF_0106 in Desulfovibrio vulgaris Miyazaki F

Name: rplQ
Annotation: 50S ribosomal protein L17 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00059: ribosomal protein bL17
  • amino acids 7 to 117 (111 residues), 124.6 bits, E=1.1e-40
• PF01196: Ribosomal_L17
  • amino acids 20 to 116 (97 residues), 111.8 bits, E=1.2e-36

Best Hits

Swiss-Prot: 100% identical to RL17_DESVM: 50S ribosomal protein L17 (rplQ) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K02879, large subunit ribosomal protein L17 (inferred from 100% identity to dvm:DvMF_0106)

MetaCyc: 52% identical to 50S ribosomal subunit protein L17 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L17p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

See B8DNL0 at UniProt or InterPro

Protein Sequence (133 amino acids)

>DvMF_0106 50S ribosomal protein L17 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRHSNSGKKLGRTPSHRKALFRNMAKALLTYGKIRTTETKAKELRRIVEPLITLALRNDL
HSRRLAYDVLGSHQLVKRLFDDIGPAFVGVSGGFTRVVKLGLPRKGDNAPLAVIELTHQP
AAEAPAEEKKAAE