Protein Info for DvMF_0076 in Desulfovibrio vulgaris Miyazaki F

Annotation: 30S ribosomal protein S7 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF00177: Ribosomal_S7" amino acids 2 to 149 (148 residues), 215.6 bits, see alignment E=1.1e-68 TIGR01029: ribosomal protein uS7" amino acids 3 to 156 (154 residues), 224.6 bits, see alignment E=2.7e-71

Best Hits

Swiss-Prot: 100% identical to RS7_DESVM: 30S ribosomal protein S7 (rpsG) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K02992, small subunit ribosomal protein S7 (inferred from 100% identity to dvm:DvMF_0076)

MetaCyc: 58% identical to 30S ribosomal subunit protein S7 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S7p (S5e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DN93 at UniProt or InterPro

Protein Sequence (156 amino acids)

>DvMF_0076 30S ribosomal protein S7 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPRKGPVPRREILPDPVYNSRLAARFINRLMYDGKKGVAEKLFYKSLETLGEKTGEEPLK
AFERAVESVKPHLEVKARRVGGATYQVPMDVRPDRQVSLAIRWLINYARSRGEKGMSAKL
SAELIDAFNSRGGAVKKKEDTHRMAEANKAFAHYRW