Protein Info for DvMF_0066 in Desulfovibrio vulgaris Miyazaki F

Annotation: Polysulphide reductase NrfD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 160 to 185 (26 residues), see Phobius details amino acids 192 to 219 (28 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details amino acids 314 to 336 (23 residues), see Phobius details amino acids 356 to 377 (22 residues), see Phobius details PF03916: NrfD" amino acids 41 to 337 (297 residues), 118.8 bits, see alignment E=2e-38

Best Hits

KEGG orthology group: K00185, molybdopterin oxidoreductase, membrane subunit [EC: 1.2.7.-] (inferred from 100% identity to dvm:DvMF_0066)

MetaCyc: 87% identical to DsrP (Desulfovibrio vulgaris Hildenborough)
1.8.5.h [EC: 1.8.5.h]

Predicted SEED Role

"Sulfite reduction-associated complex DsrMKJOP protein DsrP (= HmeB)" in subsystem Sulfate reduction-associated complexes

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.-

Use Curated BLAST to search for 1.2.7.- or 1.8.5.h

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DN83 at UniProt or InterPro

Protein Sequence (387 amino acids)

>DvMF_0066 Polysulphide reductase NrfD (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MIEKVLKGSPAFYIWLLFLGGIASLGVFAYIFQLKYGLTITGMSRDVSWGLYISQFTYFV
GVAASAVMLVLPAYFHHYKKFKKMIILGEFMAISAVLMCMLFIVTDMGQPQRMLNVILHP
TPNSIMFYDMMVLMGYLFINALVGWVTLEAERHDVDPPKWIKFFIYLSVVWAFSIHTVTA
FLYAGLPGRHYWLTAIMAARFLSSAFASGPAILLLLVMALRRLTGFDPGREAIQTLTKII
TYAMAINVFFFLLEVFTAFYSGMPGHQHPLTFLFVGHDGHASWVVGWMWTAAVLAMLSLC
LLIPPQFRDNERVLPWALGILVIASWIDKGLGLLIGGFTPNPFETVTEYAPTFPEILVTV
GIYAIGLMVLSVLWKIALDVKKEAGTF