Protein Info for DvMF_0034 in Desulfovibrio vulgaris Miyazaki F

Annotation: RND efflux system, outer membrane lipoprotein, NodT family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 29 to 493 (465 residues), 331.5 bits, see alignment E=4.4e-103 PF02321: OEP" amino acids 85 to 278 (194 residues), 94.7 bits, see alignment E=3.1e-31 amino acids 306 to 492 (187 residues), 102.5 bits, see alignment E=1.2e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0034)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DN51 at UniProt or InterPro

Protein Sequence (538 amino acids)

>DvMF_0034 RND efflux system, outer membrane lipoprotein, NodT family (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTLPARTLALGTQAPAVPAASRCLPLLLLLLFMLSACAKVGPDFSAPDTAMPTGWQDAAV
LGATATREVSEEWWRTFDDATLNGLLAEARGGNLSLQVTALRVLEARARLGVAVGNLYPQ
RQQATGGLTWTHPSDRTPTAPQPGTGRGNPDYVQTSVGLDAAWELDFWGKYRRGVEAADA
DLRAAAADYEAAMVAVTANVAQSYVLYRTLQQQLAIADNNVAIQRESLRIATARFNYGAT
SERDMRQALSLLRDTEASIPSLAHSLREARNALCVLLGKPPQDLAAMLGTAPIPTAPAGL
ALGIPADLLRRRPDVRKAEYAAAGQCARLGVAKADFYPSISLGGFVGFTASNVGAFSTGD
TFSHGFTAYGGPGLTLPLFNYGRIANNVRAQDARFQQALTAYRETVLSALRETEDGIDRY
LNAQGRAALLTESAADAARSLELAMVQYQEGSTDFTTVLTAARDLSTRQDALAQASGEIS
QSLVAVFKALGGGWRTLPENGPIPLETQREMRARTDWGALPEEHGAVPAGGDVRPPDI