Protein Info for DvMF_0026 in Desulfovibrio vulgaris Miyazaki F

Annotation: succinyl-CoA synthetase, alpha subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08442: ATP-grasp_2
  • amino acids 3 to 191 (189 residues), 124.3 bits, E=1.3e-39
• PF00549: Ligase_CoA
  • amino acids 251 to 344 (94 residues), 61.6 bits, E=2.1e-20
  • amino acids 567 to 686 (120 residues), 59 bits, E=1.4e-19
• PF02629: CoA_binding
  • amino acids 423 to 514 (92 residues), 89.9 bits, E=3.8e-29
• PF13380: CoA_binding_2
  • amino acids 433 to 543 (111 residues), 29 bits, E=3.2e-10

Best Hits

KEGG orthology group: K01902, succinyl-CoA synthetase alpha subunit [EC: 6.2.1.5] (inferred from 100% identity to dvm:DvMF_0026)

Predicted SEED Role

No annotation

MetaCyc Pathways

• reductive TCA cycle I (9/11 steps found)
• incomplete reductive TCA cycle (6/7 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• pyruvate fermentation to acetate VI (2/3 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (18/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (15/22 steps found)
• pyruvate fermentation to acetate V (1/3 steps found)
• TCA cycle I (prokaryotic) (6/10 steps found)
• TCA cycle III (animals) (6/10 steps found)
• TCA cycle VIII (Chlamydia) (3/6 steps found)
• TCA cycle II (plants and fungi) (5/9 steps found)
• reductive TCA cycle II (7/12 steps found)
• superpathway of glyoxylate bypass and TCA (7/12 steps found)
• adipate biosynthesis (1/5 steps found)
• adipate degradation (1/5 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (3/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (7/17 steps found)
• methylaspartate cycle (8/19 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• C5-Branched dibasic acid metabolism
• Citrate cycle (TCA cycle)
• Propanoate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.5

Sequence Analysis Tools

See B8DN44 at UniProt or InterPro

Protein Sequence (709 amino acids)

>DvMF_0026 succinyl-CoA synthetase, alpha subunit (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MFLNEHQSKKLFAAAGIAVPAGDCLGPEDVDAYAPPFPGPWYVKAQVLTGGRGKAGGVLR
ADTPDALRATARTILGMTIKGHAVPFVRVEPATDIRKECYLSFMLSRQRREMLLTTSHRG
GMEVEATADSRKPLVQRVPLDAGLREHHLRAAFFELGADPAGWAGFRDLAERLFRAVRDD
GLLLAEINPLVFTGAGQWVALDGKVELDDNVVDLRPDLQGYYTPEHHGAEENAARDAGLS
YVGLSGWVGLLVNGAGLAMATMDLLNFSGLPAANFMDLGGAADGARMRRALDLLFANPQV
RAVFINLFGGIVSCAGVARALMEALGTERAAQPVVVRMAGHESAEGRELLRAFAHPDVII
ADEVTDALDALRRLDEAHRAAGTAPAVPPVAYPLADEAWPLPPAARKGYRRSGRRGVPWL
GPDTQVLVQGITGKVAQRHVQLMQEYGTHIVAGVTPFKGGQSVLGVPVYDSVHEACRHHR
IDASIIFVPAPFAPDAVMEAAAEEIPWAVCITEGIPQRAMLSALKNVPPSPTRVIGPNTP
GIIVPGATKIGIMPGYVFTPGPVAIFSRSGTLTYEAAARLSAAGIGQSFCAGVGGDSFIG
SDFISLFECIRDDDATEAVLVLGEVGGTAEEDLARWVTATGFAKPVLGFIAARTAPPGRR
MGHAGAILDEATGGVDGKLQAMRDAGFAVCPDLASLPERVARALGRDAD