Protein Info for DvMF_0013 in Desulfovibrio vulgaris Miyazaki F

Annotation: fructose-1,6-bisphosphate aldolase, class II (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 TIGR00167: ketose-bisphosphate aldolase" amino acids 6 to 306 (301 residues), 320.7 bits, see alignment E=9.3e-100 TIGR01859: fructose-1,6-bisphosphate aldolase, class II" amino acids 7 to 307 (301 residues), 375.8 bits, see alignment E=1.7e-116 PF01116: F_bP_aldolase" amino acids 7 to 306 (300 residues), 362.9 bits, see alignment E=6.3e-113

Best Hits

Swiss-Prot: 47% identical to ALF_THECA: Fructose-bisphosphate aldolase (fba) from Thermus caldophilus

KEGG orthology group: K01624, fructose-bisphosphate aldolase, class II [EC: 4.1.2.13] (inferred from 100% identity to dvm:DvMF_0013)

Predicted SEED Role

"Fructose-bisphosphate aldolase class II (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.13

Use Curated BLAST to search for 4.1.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DN31 at UniProt or InterPro

Protein Sequence (307 amino acids)

>DvMF_0013 fructose-1,6-bisphosphate aldolase, class II (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MPLTGPKQMFERAYKEGYAIGAFNVNNMEIIQGIMQAAGEEQAPLILQVSAGARKYAGQN
YIVKLIEAALMDTDLPVVLHLDHGQDFNICKDCIDGGFTSVMYDGSHLPYEENIAVTRQV
VEYAHARGVWVEAELGQLAGVEDEVSAEHSVYTDPDQAVDFVKRTGCDSLAIAIGTSHGA
YKFTGEAKLDFARLEKITSMLPGYPLVLHGASSVPQEFVDMANTYGGKVGSAKGVPEDLL
RKAATYGVCKINIDTDIRLAMTATIRKHFMEKPADFDPRAYLKPARDAVKNMVQHKIRNV
LGCSNKI