Protein Info for Shewana3_4131 in Shewanella sp. ANA-3

Annotation: F0F1 ATP synthase subunit gamma (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR01146: ATP synthase F1, gamma subunit" amino acids 1 to 286 (286 residues), 368.7 bits, see alignment E=1.4e-114 PF00231: ATP-synt" amino acids 4 to 286 (283 residues), 359.7 bits, see alignment E=7.4e-112

Best Hits

Swiss-Prot: 100% identical to ATPG_SHESA: ATP synthase gamma chain (atpG) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K02115, F-type H+-transporting ATPase subunit gamma [EC: 3.6.3.14] (inferred from 99% identity to shm:Shewmr7_4018)

MetaCyc: 72% identical to ATP synthase F1 complex subunit gamma (Escherichia coli K-12 substr. MG1655)
ATPSYN-RXN [EC: 7.1.2.2]; RXN0-7041 [EC: 7.1.2.2]

Predicted SEED Role

"ATP synthase gamma chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14 or 7.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2S9 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Shewana3_4131 F0F1 ATP synthase subunit gamma (RefSeq) (Shewanella sp. ANA-3)
MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVAQGS
LEYKHPYLEVREAKRVGYIVVATDRGLCGGLNVNLFKKVVSDVKSWKEQGAEFEFCPIGA
RSVQFFKSFGGQVSAHASGLGDAPKLADLIGTVRVMLDAYNEGKLDRLYVVFNKFVNTMT
QTPVIEQLLPLPKSEDDEVAHRWDYIYEPDPKALLDTLLVRYVESQVYQGVVENIASEQA
ARMVAMKAATDNAGTLIDDLQLVYNKARQAAITQELSEIVSGASAV