Protein Info for Shewana3_4085 in Shewanella sp. ANA-3

Annotation: glycosyl transferase family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details amino acids 170 to 202 (33 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details amino acids 308 to 326 (19 residues), see Phobius details amino acids 332 to 352 (21 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details amino acids 400 to 418 (19 residues), see Phobius details amino acids 425 to 447 (23 residues), see Phobius details PF02366: PMT" amino acids 44 to 230 (187 residues), 36 bits, see alignment E=6e-13 PF13231: PMT_2" amino acids 70 to 231 (162 residues), 65.9 bits, see alignment E=5e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_4085)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2N3 at UniProt or InterPro

Protein Sequence (574 amino acids)

>Shewana3_4085 glycosyl transferase family protein (RefSeq) (Shewanella sp. ANA-3)
MDALNRRFNSEDYYQVLWPLLLMSLLILLVGIGFRSPWPADEPRFVEVAREMVASGQWLF
PTRGGEYYPDKPPVFMWAIALFYQLTGSLKLSFLLPNAFCGLLTVFLVYDLGARLWNVRV
GRNAALLLLIVPQFLMQAKNAQIDAMVMCWITVGCYGLIRHFMLGPKWHWYFIGWAFMGL
GVITKGVGFLPLLLLIPIGIYAFKDKTRFEGRLTWLCLAGPLAMLAVIACWLVPMVMTVQ
AHGTPEMVAYQNNILFKQTGERYVNAWHHIKPWYFFVLSVIPWMWFPISLLVVAYWKQWL
QKVKADPTIAILLIWVGLVVLFFSISPGKRNVYILPALPMLALAASAVLTGVSPKAWFEK
LVTGVLWFLGALVLVAGVLAFIHHPALVKALADYTDDLTGIGYLFILLGVLWCALLWLAR
RQFALVKVGLVSALGWVLVSTWGYAMLDEMRTPRSLMLHTAEVIGEDAELGLVNFKEQFI
LFSPMSVTHFSYLAPVEEQERNAWQWMQENKQRYVLVPSGAELSCFDIKGGKSMGIAHRD
EWILLSASELKPQCQAPERVYRYFTDHPGRWLKE