Protein Info for Shewana3_4060 in Shewanella sp. ANA-3
Annotation: malate synthase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01638, malate synthase [EC: 2.3.3.9] (inferred from 100% identity to she:Shewmr4_3852)Predicted SEED Role
"Malate synthase-related protein" in subsystem Serine-glyoxylate cycle
MetaCyc Pathways
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
- glyoxylate cycle (6/6 steps found)
- superpathway of glyoxylate bypass and TCA (10/12 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
- glycolate and glyoxylate degradation II (2/2 steps found)
- chitin deacetylation (3/4 steps found)
- superpathway of glycol metabolism and degradation (5/7 steps found)
- L-arabinose degradation IV (4/8 steps found)
- D-xylose degradation IV (1/7 steps found)
- crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (1/14 steps found)
- superpathway of pentose and pentitol degradation (10/42 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.3.3.9
Use Curated BLAST to search for 2.3.3.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0L2K8 at UniProt or InterPro
Protein Sequence (187 amino acids)
>Shewana3_4060 malate synthase (RefSeq) (Shewanella sp. ANA-3) MNMSIINSHQIQPNLNSFIAEEVLAVAQVNVAEHEKLAQAKQFLDRHFPLDTGSHQDVIS YVVYYQHLLAFFADGSHSGLRQTKQFVAFNGTKDAPSAIVLQDQGCHVELCFDRTGMIGA RDLANLEDVQIEAPVELAAEPTETRNTTSRHWLSLLHAGMPSANDIQDKLFTAKDGGDYS LQRIVNL