Protein Info for Shewana3_4033 in Shewanella sp. ANA-3

Annotation: cytochrome c oxidase, subunit III (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00510: COX3
  • amino acids 27 to 204 (178 residues), 53.1 bits, E=2.2e-18
• TIGR02842: cytochrome o ubiquinol oxidase, subunit III
  • amino acids 27 to 206 (180 residues), 278 bits, E=2.3e-87

Best Hits

Swiss-Prot: 68% identical to CYOC_PSEAE: Cytochrome bo(3) ubiquinol oxidase subunit 3 (cyoC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02299, cytochrome o ubiquinol oxidase subunit III [EC: 1.10.3.-] (inferred from 99% identity to shm:Shewmr7_3916)

MetaCyc: 65% identical to cytochrome bo3 subunit 3 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (2/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (2/2 steps found)
• proline to cytochrome bo oxidase electron transfer (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

See A0L2I1 at UniProt or InterPro

Protein Sequence (206 amino acids)

>Shewana3_4033 cytochrome c oxidase, subunit III (RefSeq) (Shewanella sp. ANA-3)
MSVAIPADLEVAHAEEHHEHHDTGGNTLFGFWLYLMTDCILFASVFATYAVLYMNTDGGV
SGKDIFELDFVLIETAALLLSSITYGFALIFAKRHNKAATLTWLAITFALGCVFIGMEVY
EFHHLIEHGNGPQRSAFLSSFFTLVGMHGLHVTAGLIWMAIMMIEVAKTGLGNRSITRLS
CLSLFWHFLDIVWICVFTVVYLLGAL