Protein Info for Shewana3_4029 in Shewanella sp. ANA-3

Annotation: diguanylate cyclase/phosphodiesterase with PAS/PAC and Chase sensor(s) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1100 1228 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 496 to 518 (23 residues), see Phobius details PF05231: MASE1" amino acids 32 to 199 (168 residues), 55.2 bits, see alignment E=2.7e-18 PF03924: CHASE" amino acids 272 to 445 (174 residues), 91.4 bits, see alignment E=2.9e-29 TIGR00229: PAS domain S-box protein" amino acids 553 to 674 (122 residues), 73.4 bits, see alignment E=1.9e-24 amino acids 679 to 798 (120 residues), 66.2 bits, see alignment E=3.2e-22 PF13188: PAS_8" amino acids 556 to 600 (45 residues), 22.3 bits, see alignment (E = 4.3e-08) amino acids 679 to 730 (52 residues), 28.2 bits, see alignment (E = 5.9e-10) PF00989: PAS" amino acids 557 to 667 (111 residues), 23.2 bits, see alignment E=2.6e-08 amino acids 680 to 789 (110 residues), 38.4 bits, see alignment E=4.9e-13 PF08448: PAS_4" amino acids 575 to 672 (98 residues), 29.5 bits, see alignment E=3.3e-10 amino acids 684 to 793 (110 residues), 25.5 bits, see alignment E=5.9e-09 PF13426: PAS_9" amino acids 575 to 669 (95 residues), 37.4 bits, see alignment 1.2e-12 amino acids 689 to 791 (103 residues), 55.2 bits, see alignment E=3.4e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 801 to 961 (161 residues), 156.8 bits, see alignment E=4.2e-50 PF00990: GGDEF" amino acids 803 to 959 (157 residues), 169.4 bits, see alignment E=2.5e-53 PF00563: EAL" amino acids 981 to 1214 (234 residues), 271.3 bits, see alignment E=3e-84

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_4029)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2H7 at UniProt or InterPro

Protein Sequence (1228 amino acids)

>Shewana3_4029 diguanylate cyclase/phosphodiesterase with PAS/PAC and Chase sensor(s) (RefSeq) (Shewanella sp. ANA-3)
MRIKALWCLSEFRLSNKKGLYIKAFAHYLKVNILVALAYFVVGKIGLLIALPPGYSAAIW
PAAGIAIASCIMWRQYAPWFGVLLGSWLININIGGALHLGWLPIAIASASSLQAYVSAKV
IRRIDPVFTLDKPNTVIKSCLSLALTCMIATLFANAALVVHGTIPLKDALGSTVNWWIGD
LLGAVIFIPLTMLIFDQRSIWRSRRVQTGLPLLVGFLFCVGIYYYSDMNQRQQLQDKFQI
QSNAIISSVESFQESNLQQVIALASLFDNSEQVSEDEFIQFGKRNQLQLDGFRAWAWSPL
IAASDKDSFETETSTELGEPYKIRYLEGGAPNADGWLVPVKFVQPMNTSRAALGLDINGE
PSRAAAIAKVRATLSPVMTGKIQLAEDPNGPGGTLFLAPVFDRLGNIVGFCSAVIDLQSI
INEVEQVKGLHWRLTDMSAKGALLYANSQKTFPDFEGNIHSDKMGQYFQANLMLADRHWH
IVIYESYSSLMGDTFSLSLLMLLLAFITCAVVGGMTLVSSGERHRIAEKVAEKTMALSKE
IARSQTFQATLMESEQRYRTLFDKAPVGHALKRLEDGQFVAINQAFMEITGYTLEELQAI
DPWELTPIRYQSSETEQLERLKQTRRYGPYQKHYRHKDGQLVAVRLNGSLVTAANGEQLI
LFIVEDITEQERTVARVNLLAQVFQQSGEGITIMDANDIIVDVNSAFTQITGYSRDEIIG
KNCRFLEAERTDRSIDAQVRAALEQTGFWQGEVWDRHKEGFDFPKWLMMSIVRDETGAIS
HYIGSFTDISERKVNEERIHFLAHHDSLTLLPNRLSLQSRLEKVFQEAFISQTQIAVMFI
DMDHFKNINDTLGHHVGDMLLLEVARRLKNIMGNDDIVARLGGDEFVVVLSDTDHDRVAK
VAEALRSGLNQTYLIDNKPLHSSPSIGISLFPTDGDSVEALMKNADMAMYRAKAAGRNNY
QFFTAAMNTLVTERQQIETGLRQAIACNELLLYYQPQVDISSGQVVGVEALIRWQHPELG
LVAPDRFIPIAEEIDMIIPIGQWVLENALAQLAEWRDKGAKGLRMAVNLSAHQLRKDTIV
ADIINVLTKHKLGKGALELEITESVAMQYPEQNAKLLAELRQHGIELAIDDFGTGYSSLS
YLKLLPLDRLKLDRSFVKDIESDPNDAAISAATISMAHELGLTVVAEGVENEAQLVLLSG
MGCDLVQGYYFSKPLAADDCFRFIERNF