Protein Info for Shewana3_4012 in Shewanella sp. ANA-3

Annotation: sulfatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 220 to 231 (12 residues), see Phobius details PF00884: Sulfatase" amino acids 291 to 561 (271 residues), 165.4 bits, see alignment E=9.9e-53

Best Hits

Swiss-Prot: 61% identical to Y1246_HAEIN: Uncharacterized protein HI_1246 (HI_1246) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_4012)

Predicted SEED Role

"Phosphoglycerol transferase I (EC 2.7.8.20)" (EC 2.7.8.20)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2G0 at UniProt or InterPro

Protein Sequence (654 amino acids)

>Shewana3_4012 sulfatase (RefSeq) (Shewanella sp. ANA-3)
MQSGLSARGRQPAHGPFRVILIFSLLVLAIATASRIGLGLWQGERVAAVDGWSHLLLQGI
RVDIATLCWLWGVAALGTALFSGDHLLGRIWQGVLRLWLTLGLWAIVFLEVSTPAFIEEY
GIRPNRLYVEYLIYPKEVLSMLWAGRKLELIFSVLLTLATLWGGWTLSGKLTKNLRFPRW
YWRPVLAVMVIVVTLLGARSTLGHRPINPAMVAFADDPLVNSLVINSAYSLVFAIKQMGS
EEDASKVYGSLDRDEIINTIRQESGRPESAFTSSDIPSLSFNQASYNGKPKNLVILLQES
LGARFVGSLGGMPLTPNIDALSQEGWYFDNLYATGTRSVRGIEAVTTGFTPTPARAVVKL
GKSQTGFFTLAELLKNHGYTTPFIYGGESHFDNMRSFFLGNGFSDIIDQKDYQSPAFVGS
WGASDEDLMRKANSEFERLHSEGKSFFSLVFSSSNHDPFEFPDGRIELYEQPKQTRNNAA
KYADYAIGEFFKLAKNADYWKDTVFIVVADHDSRVGGADLVPVSRFRIPGLIIGDNVAPK
RDHRVVSQIDLPPTLLSLIGISDSYPMLGRDLTQVSDDWPGRALMQYDKNFALMEGKDVV
ILQPEKAAQGFQYDEKTEHLTPYAPAAQALEKKALGWALWGSLAYQQELYRSGK