Protein Info for Shewana3_4007 in Shewanella sp. ANA-3

Annotation: two component transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 87.7 bits, see alignment E=6e-29

Best Hits

Swiss-Prot: 33% identical to MPRA_MYCSS: Response regulator MprA (mprA) from Mycobacterium sp. (strain MCS)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_4007)

Predicted SEED Role

"DNA-binding response regulator ColR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2F5 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Shewana3_4007 two component transcriptional regulator (RefSeq) (Shewanella sp. ANA-3)
MLVLLVEDNRLLSNNIIQYLELSGIECDYAFNLAQADMLISQQQFDVVILDLNLPDGDGI
KACERWKAQCITSPIIMLTARSSLRERLDGFAVGADDYLVKPFAMEELVARLKVVAQRRP
APQRLVIGDLEIDFGNHLVYRQDQLLTLSKTSWQILALLARRSPETVSREEIERVIWPDT
IPDSDSLRSHIHLLRRVIDRPFKSQLLHTIRGVGLSLRDDFDANA