Protein Info for Shewana3_3995 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details PF02104: SURF1" amino acids 51 to 271 (221 residues), 109 bits, see alignment E=2.1e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3995)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Surf1, facilitates heme A insertion" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2E4 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Shewana3_3995 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MINSNSSTKTHLKMNGMFIRYPYVLLTKLIGLPRYIWLHRGMLLLLILTVVVFVILVKLG
LWQMDRAAEKTELLAQMEARQSAAALNPEQLIAELAKGGVTGYRLEVQASPVNPQIWLLD
NQVYQGQVGYLAFQLLQISPENQANDAEQPWLLLELGFIAAKSHRDALPEVSPIVGEQVL
TGRLYQKQINPLSHHLLAEPFTTEQGERIRFQNLNLPEMAQMLGHPILPAVLQPDALPQL
QPAQALPHPWQPFPLSAQKHWGYALQWFAMATVFAGLMGWQGAKYLKKSRQLHRADKEAT
KTE