Protein Info for Shewana3_3992 in Shewanella sp. ANA-3

Annotation: cytochrome c oxidase, subunit I (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 162 to 189 (28 residues), see Phobius details amino acids 201 to 227 (27 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details amino acids 392 to 414 (23 residues), see Phobius details amino acids 426 to 450 (25 residues), see Phobius details amino acids 470 to 490 (21 residues), see Phobius details TIGR02891: cytochrome c oxidase, subunit I" amino acids 26 to 529 (504 residues), 713.8 bits, see alignment E=5.6e-219 PF00115: COX1" amino acids 34 to 476 (443 residues), 543.4 bits, see alignment E=2e-167

Best Hits

Swiss-Prot: 55% identical to COX1_BRADU: Cytochrome c oxidase subunit 1 (ctaD) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 100% identity to she:Shewmr4_3792)

MetaCyc: 79% identical to cytochrome c oxidase subunit 1 (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2E1 at UniProt or InterPro

Protein Sequence (530 amino acids)

>Shewana3_3992 cytochrome c oxidase, subunit I (RefSeq) (Shewanella sp. ANA-3)
MSTLTQDQIAAHDEHHHGAPKGIMRWLLTTNHKDIGTLYLWFSFIMFLTGGAMAMVIRAE
LFQPGLQLVEPNFFNQMTTVHGLIMVFGAVMPAFTGLANWLIPMMIGAPDMALPRMNNWS
FWILPFAFTILLSSLFMEGGGPNFGWTFYAPLSTTYSPDSTALFVFSIHIMGISSIMGAI
NVIVTIVNLRAPGMTWMKLPLFVWTWLITAFLLIAVMPVLAGAVTMVLTDKFFGTSFFEA
AGGGDPVMFQHIFWFFGHPEVYIMILPSFGIISAIVPAFSRKKLFGYSSMVYATASIAIL
SFLVWAHHMFTTGMPVFAELFFMYCTMLIAVPTGVKVFNWVATMWRGSLSFETPMLFAVA
FIILFTIGGFSGLMLAITPADFQYHDTYFVVAHFHYVLVTGAIFSIMAAAYYWLPKWTGH
MYSEKLGQWHFWCSVISVNVLFFPMHFLGLAGMPRRIPDYSIQFADVNQIVSIGGFAFGL
SQLIFLVLVIKCIRGGEKAPAKPWEGSEGLEWTLPSPAPYHSFTTPPEVK