Protein Info for Shewana3_3961 in Shewanella sp. ANA-3

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF12838: Fer4_7" amino acids 50 to 113 (64 residues), 31.5 bits, see alignment E=6.9e-11 amino acids 96 to 144 (49 residues), 35 bits, see alignment 5.7e-12 PF13247: Fer4_11" amino acids 90 to 186 (97 residues), 82.8 bits, see alignment E=6.2e-27 PF13237: Fer4_10" amino acids 93 to 141 (49 residues), 35.6 bits, see alignment 2.4e-12

Best Hits

Swiss-Prot: 58% identical to NRFC_HAEIN: Protein NrfC homolog (nrfC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04014, formate-dependent nitrite reductase, Fe-S protein (inferred from 98% identity to shm:Shewmr7_3836)

Predicted SEED Role

"NrfC protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2B0 at UniProt or InterPro

Protein Sequence (228 amino acids)

>Shewana3_3961 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MENSKRRFLKGTCALLAGASGATLLATVSASNEAKAEPSVKYALIHDETKCIGCKACEVA
CRETNHVPEGVARLKIEQTGPYGEYPNQFYHFSRKSCQHCEDAPCVNVCPTGAAFIDKET
GIVSVDAWKCVGCQYCIAACPYKIRFINPVTHAADKCDFCRETNLAQGKQPACVAACPTK
ALVFGNLKDPSSQVVQVLKANPTQRAKVDLGTRPKLFRIVAKSGEVAI