Protein Info for Shewana3_3960 in Shewanella sp. ANA-3

Annotation: polysulphide reductase, NrfD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 48 to 70 (23 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 134 to 161 (28 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details TIGR03148: cytochrome c nitrite reductase, NrfD subunit" amino acids 2 to 313 (312 residues), 357.7 bits, see alignment E=3e-111 PF03916: NrfD" amino acids 5 to 312 (308 residues), 234.6 bits, see alignment E=1.1e-73

Best Hits

KEGG orthology group: K04015, formate-dependent nitrate reductase complex, transmembrane protein (inferred from 99% identity to shm:Shewmr7_3835)

Predicted SEED Role

"NrfD protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2A9 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Shewana3_3960 polysulphide reductase, NrfD (RefSeq) (Shewanella sp. ANA-3)
MSALHFDTLVWHWPIAIYLFLAGASAGAMFFAVLLKHFVLKHNAYQSGFVQAACIVAPVA
VMAGLGILVLDLTKPFDFWKILVFYNPKSVMSMGVLILLIYQVFMFMWIGLLFRKPIDAW
CESRFPIVLKFTAWLSRFEATITGLLVIFSLALGAYTGFLLSALPGYPMLKNPVLPLLFL
ASGLSSGAASSLLGGVLLNANPNAKEVHFIHKVEIPLILVEIVLIFTFFMGLVLSGGQSK
FAAFNAIGYGFWGWIFWIGIVGLGLSGPLAMNLFMTATSKRKWAYVAGTACLSLIGVLLL
RNFILYTGQMTVV