Protein Info for Shewana3_3926 in Shewanella sp. ANA-3

Annotation: coproporphyrinogen III oxidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF04055: Radical_SAM" amino acids 66 to 231 (166 residues), 71.2 bits, see alignment E=6.3e-24

Best Hits

KEGG orthology group: K00224, [EC: 1.3.1.-] (inferred from 99% identity to son:SO_4520)

MetaCyc: 99% identical to menaquinone C8-methyltransferase (Shewanella oneidensis MR-1)
RXN-18515 [EC: 2.1.1.350]

Predicted SEED Role

"Oxygen-independent coproporphyrinogen III oxidase, putative"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.- or 2.1.1.350

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L275 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Shewana3_3926 coproporphyrinogen III oxidase (RefSeq) (Shewanella sp. ANA-3)
MSSVIQTLNRAIATPYQANITVPNWMLSSMERVMQYYVDKNLRLDTLSADIMPAPVEGKK
YMLYAHVPFCHTLCSYCTFHRFMFKEDKARAYFISLRKEMEMVKALGYDFESMYIGGGTT
TVLEDELARTIEHAKTLFPSIKEVSCESDPQHLDSPGFKQLKGLVDRMSIGVQSFNDDIL
KMTDRLEKFGTGQQTFDKIMAAKELFPIINVDLIFGFRGQTDEVIQHDLDMASRLDPRQI
TTYPLMITHQTRKSVKGKLAAPQADMANQYRQILNRLNGQYNQLSAWAFGKANDEGFDEY
VIDYDEYLGVGSGSFSFLNDTLYVNTFSLRKYQERIAAGKMGVEQQKNYSKKDVMQYRFL
LGMFSGRLSRKYFRETFGVNLDTALFKEMTSMKLIGAIKNDPTDPDNLIITDNGKMMGLL
MMKEFYAGMDNVRAQLRKPLKPCDM