Protein Info for Shewana3_3876 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 116 to 137 (22 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details amino acids 320 to 337 (18 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details PF06738: ThrE" amino acids 12 to 250 (239 residues), 216.5 bits, see alignment E=3.9e-68 PF12821: ThrE_2" amino acids 276 to 398 (123 residues), 54.5 bits, see alignment E=1.4e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to shm:Shewmr7_0273)

Predicted SEED Role

"Protein of unknown function DUF1212"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L225 at UniProt or InterPro

Protein Sequence (406 amino acids)

>Shewana3_3876 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MDNEQFLEKRKFIIKLGKALHKFGTPAYRLETHLQTVSRTLGIEGYFLISPTSMTFVLQH
DTDQEYNHVARVKPGELDLGSLARTDELVDELTSGKRTLTEALDRLEEIANKPNPYGPAL
TCFSFGTSAAAFAMLMGTGWNDVFWSGLLGLLVYGFVYRAERSTRMAEVLEPFATIVCAI
AACAIARIDPNINIPVVILSSIIIFIPGLALTLGLAELAARDLISGTARIMDASMLLFKL
YFGAVLGMAIGKAFFGEAIHIEPEGLPRWAIWSAVPILSMALVFIFKARMQDSPWGVLAG
IVAFFSAMLGGHFFGDSVGIFFGALAVGVYSNLFARWMKAPASIALLQGIVILVPGSKTY
IGLNALISGETMLNQSHIGSQIFLIFMSLIAGLIFANVVVPPRRTL