Protein Info for Shewana3_3775 in Shewanella sp. ANA-3

Name: folE
Annotation: GTP cyclohydrolase I (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00063: GTP cyclohydrolase I
  • amino acids 37 to 214 (178 residues), 258.8 bits, E=1.1e-81
• PF01227: GTP_cyclohydroI
  • amino acids 38 to 214 (177 residues), 206.4 bits, E=1.3e-65

Best Hits

Swiss-Prot: 100% identical to GCH1_SHESM: GTP cyclohydrolase 1 (folE) from Shewanella sp. (strain MR-4)

KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 100% identity to shm:Shewmr7_0354)

MetaCyc: 69% identical to GTP cyclohydrolase 1 (Escherichia coli K-12 substr. MG1655)
GTP cyclohydrolase I. [EC: 3.5.4.16]

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• tetrahydromonapterin biosynthesis (3/4 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• preQ₀ biosynthesis (2/4 steps found)
• erythro-tetrahydrobiopterin biosynthesis I (1/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (1/4 steps found)
• drosopterin and aurodrosopterin biosynthesis (3/7 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.16

Sequence Analysis Tools

See A0L1S4 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Shewana3_3775 GTP cyclohydrolase I (RefSeq) (Shewanella sp. ANA-3)
MALSEAAVKVQAALQERGLETPMLPNVFTPEERKDKIEFHMKEILTLMSLDLSDDSLADT
PRRIAKMYVDEIFSGLDYENFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTAT
IAYIPRKKIIGLSKINRIVRFFSQRPQVQERLTQQVLVALQTLLETKDVAVKMDAVHYCV
KSRGVMDSTSSTTTTALGGIFKSNPATRAEFLNQSK