Protein Info for Shewana3_3752 in Shewanella sp. ANA-3

Annotation: cell division protein MraZ (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 TIGR00242: division/cell wall cluster transcriptional repressor MraZ" amino acids 1 to 151 (151 residues), 171.5 bits, see alignment E=4.9e-55 PF02381: MraZ" amino acids 1 to 75 (75 residues), 63.4 bits, see alignment E=7.6e-22 amino acids 78 to 138 (61 residues), 68.5 bits, see alignment E=1.9e-23

Best Hits

Swiss-Prot: 100% identical to MRAZ_SHESA: Transcriptional regulator MraZ (mraZ) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K03925, MraZ protein (inferred from 97% identity to sbl:Sbal_0393)

Predicted SEED Role

"Cell division protein MraZ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1Q1 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Shewana3_3752 cell division protein MraZ (RefSeq) (Shewanella sp. ANA-3)
MFRGASAINLDTKGRIAIPVRYREPLQLEHQGRIVITVDIQSACLLLYPIHEWELIEAKL
LKLSDTDKTQRSLKRMLLGYAHEVELDGNGRILLPPPLRQYANLDKRIMLVGQLNKFELW
DEQAWLQQIDECQETIRSEELANNERLADFSL