Protein Info for Shewana3_3742 in Shewanella sp. ANA-3

Name: murC
Annotation: UDP-N-acetylmuramate--L-alanine ligase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details PF01225: Mur_ligase" amino acids 22 to 120 (99 residues), 107.9 bits, see alignment E=4.2e-35 TIGR01082: UDP-N-acetylmuramate--L-alanine ligase" amino acids 22 to 471 (450 residues), 593.7 bits, see alignment E=1.4e-182 PF08245: Mur_ligase_M" amino acids 125 to 305 (181 residues), 101.3 bits, see alignment E=1.1e-32 PF02875: Mur_ligase_C" amino acids 327 to 462 (136 residues), 57.7 bits, see alignment E=3.4e-19

Best Hits

Swiss-Prot: 100% identical to MURC_SHESA: UDP-N-acetylmuramate--L-alanine ligase (murC) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 100% identity to she:Shewmr4_3569)

MetaCyc: 66% identical to UDP-N-acetylmuramate--L-alanine ligase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramate--L-alanine ligase. [EC: 6.3.2.8]

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1P1 at UniProt or InterPro

Protein Sequence (488 amino acids)

>Shewana3_3742 UDP-N-acetylmuramate--L-alanine ligase (RefSeq) (Shewanella sp. ANA-3)
MTKTERYLQLRSMIPEMRRIKRIHFVGIGGAGMGGIAEVLVNEGYVVSGSDIAQNAVTDR
LCLLGAKIHIGHGADNVQQADVVVVSTAINPENPEIIAAKELRIPIVRRAEMLAELMRYR
HGVAIAGTHGKTTTTSLIASLYGQAGRDPTFVIGGLLNSAGTNARLGTSRYLIAEADESD
ASFLHLQPMVSVVTNIEADHMDTYGGDFEKLKSTFVDFLHNLPFYGVAVVCIDDAVVREI
MPRIGRHMITYGFSDDADVQALNFHQQGHQCRFTVRRKGKEDLDLLLNLPGQHNVLNALA
AIAVATEDEIDDSAIIQALAEFQGIGRRFQHLGKFATPKGEVMLVDDYGHHPSEVAATIK
AARAGWPDKRLVMAYQPHRYTRTRDLYEDFIEVLSQVDCLLLLEVYSAGEAPIPGADGRA
LCRSIRLRGQLDPIFIASPDQLAEVLPDVLQEGDLLLTQGAGNIGALSRQLAASELGFSI
AATTEVKP