Protein Info for Shewana3_3733 in Shewanella sp. ANA-3

Annotation: diguanylate cyclase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 186 to 205 (20 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 367 to 386 (20 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 47 to 170 (124 residues), 77.2 bits, see alignment E=1.9e-25 PF07695: 7TMR-DISM_7TM" amino acids 185 to 385 (201 residues), 129.8 bits, see alignment E=2.1e-41 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 451 to 616 (166 residues), 172.5 bits, see alignment E=3e-55 PF00990: GGDEF" amino acids 455 to 613 (159 residues), 162 bits, see alignment E=1.6e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3733)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1N2 at UniProt or InterPro

Protein Sequence (625 amino acids)

>Shewana3_3733 diguanylate cyclase (RefSeq) (Shewanella sp. ANA-3)
MAKFGSLLVLLLGMLISFGGFANTMSIDEHTSTPLNLTPWLMVTHSNANPQLDDIQALPK
SQWHKFTSDDIQRLSQHDFWLRVNLTSGDESLARILALDNPLLDRVTIFHLVNNQLINTT
EMGDTLLYKNRPLPSNIFLYPFKLSSNEQHTFYLHIVTEGSAAIPLSLWSANDLAQIAES
TAVEHGFQLGVLAAIGIFSLFIALASGSFSYSYYSGYVLCMTLLVATINGYAFRFLWPNW
PALQQLMVPVLLPLVMAFALMFTEKILQLKYYNRRMLLMCRYSAVYIILVGLLVPFLRYG
TVLYIEIISVAILSIIMMILAIIQAINGQKLAKLYTIGWVSMLTGACISSLLYLSVIEFN
IKPQTPVMLGLTFEIIFMSLVLAIRYNDERKSKLRIQQEALKQAQKIRSAREEALKVEAE
TNERLEQMVQERTLELEITLRELHEVNQKLTEQSTIDSLTGVKNRSAFDKRLLAESRISR
RQETPIALLMLDIDRFKSINDQFGHLAGDQALKVIATTLQQHLKRPTDLVSRFGGEEFAI
ILPNTTAEGAIQVAESIRDAVTSIGLAWEGKPIPLTVSIGVSADVISNDQHSTELLEQAD
KALYQAKNSGRNQVKLYAPAQTEPT