Protein Info for Shewana3_3723 in Shewanella sp. ANA-3

Annotation: ribonuclease activity regulator protein RraA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 TIGR02998: regulator of ribonuclease activity A" amino acids 1 to 161 (161 residues), 280.9 bits, see alignment E=3.3e-88 TIGR01935: RraA family" amino acids 5 to 154 (150 residues), 213.3 bits, see alignment E=1.4e-67 PF03737: RraA-like" amino acids 5 to 152 (148 residues), 139.8 bits, see alignment E=4.4e-45

Best Hits

Swiss-Prot: 96% identical to RRAA_SHEON: Regulator of ribonuclease activity A (rraA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02553, regulator of ribonuclease activity A (inferred from 100% identity to she:Shewmr4_3549)

Predicted SEED Role

"Ribonuclease E inhibitor RraA" in subsystem RNA processing and degradation, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1M2 at UniProt or InterPro

Protein Sequence (161 amino acids)

>Shewana3_3723 ribonuclease activity regulator protein RraA (RefSeq) (Shewanella sp. ANA-3)
MEYNTSELCDMYLDVVDVVEPMFSNYGGCSSFGGSISTIKCFEDNGLITEVLQEDGQGKV
LLVDGGGSLRRALIDASIAEIAVNNNWEGIIVYGSVRDVDALEELDIGIQALASIPVGAD
GNSVGEVEIPVNFGGVTFLPGDHIYADNTGIILSPEPLDIE