Protein Info for Shewana3_3631 in Shewanella sp. ANA-3

Annotation: microcin-processing peptidase 1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF01523: PmbA_TldD_1st" amino acids 32 to 96 (65 residues), 46.8 bits, see alignment E=4.1e-16 PF19290: PmbA_TldD_2nd" amino acids 124 to 231 (108 residues), 70.2 bits, see alignment E=2.8e-23 PF19289: PmbA_TldD_3rd" amino acids 239 to 446 (208 residues), 222.6 bits, see alignment E=5.5e-70

Best Hits

Swiss-Prot: 60% identical to PMBA_ECOLI: Metalloprotease PmbA (pmbA) from Escherichia coli (strain K12)

KEGG orthology group: K03592, PmbA protein (inferred from 100% identity to shn:Shewana3_3631)

MetaCyc: 60% identical to metalloprotease subunit TldE (Escherichia coli)
3.4.24.-

Predicted SEED Role

"TldE protein, part of TldE/TldD proteolytic complex"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1D2 at UniProt or InterPro

Protein Sequence (447 amino acids)

>Shewana3_3631 microcin-processing peptidase 1 (RefSeq) (Shewanella sp. ANA-3)
MSLNRIDSELAALKDAVAVALEYANKLGTNAAEVAISKQQGLSVSTRLKEVETVEFNKDG
ALGITVYRDGCKGSSSTSDLSPEAIALAVKAADDIARYTSADPFSGLADKALMATEIRDL
KLYYPEDISPDELAQLAIRAETAALDADSRINNSDGASANAHTSVKVYGNSHGFLNGYCS
SRYSLSCSVIGEDSDGSMQRDYDYTIARKFSEMVSPESVGLKTAQKTVSRLGARKIATSR
LPILLSPEIATGLIGHLVGAISGGSLYRKSSFLLDAIHTQIFPDWFNIEEQPHLLGALAS
ANYDSEGVATQDRRIIDRGMLESYLLTSYSARKLGLTNTGHAGGIYNWTLAHTGQSFDEL
VKGMGTGLIVTEVMGQGVNMVTGDYSRGAAGFYVENGEVQFPVEEITIAGNLKDMFRGIQ
AVSRDFDLRSSIRTGGILLSEMKVAGN