Protein Info for Shewana3_3627 in Shewanella sp. ANA-3

Annotation: MiaB-like tRNA modifying enzyme YliG (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 TIGR01125: ribosomal protein S12 methylthiotransferase RimO" amino acids 38 to 466 (429 residues), 587.4 bits, see alignment E=2e-180 PF00919: UPF0004" amino acids 39 to 123 (85 residues), 73.4 bits, see alignment E=2e-24 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 39 to 467 (429 residues), 349.5 bits, see alignment E=2.6e-108 PF04055: Radical_SAM" amino acids 174 to 352 (179 residues), 89.3 bits, see alignment E=5.1e-29 PF18693: TRAM_2" amino acids 408 to 470 (63 residues), 75 bits, see alignment E=6.2e-25

Best Hits

Swiss-Prot: 100% identical to RIMO_SHESA: Ribosomal protein S12 methylthiotransferase RimO (rimO) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K14441, ribosomal protein S12 methylthiotransferase [EC: 2.-.-.-] (inferred from 100% identity to shn:Shewana3_3627)

MetaCyc: 73% identical to ribosomal protein S12 methylthiotransferase RimO (Escherichia coli K-12 substr. MG1655)
RXN0-6366 [EC: 2.8.4.4]

Predicted SEED Role

"Ribosomal protein S12p Asp88 (E. coli) methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1C8 at UniProt or InterPro

Protein Sequence (480 amino acids)

>Shewana3_3627 MiaB-like tRNA modifying enzyme YliG (RefSeq) (Shewanella sp. ANA-3)
MTVETFNPKQTTTLETPAKTLEAASADLANAESATGNRIGFVSLGCPKNLVDSERILTQL
RIDGYEVTNSYDNADLVIVNTCGFIDAAVEESLDAVREALEENGKVIVTGCLGAKENQIR
EVHPDVLEITGPHSYEAVLKHVHKYVPKPEHNPFTSLIPQTGVKLTPKHYAYLKISEGCD
NRCTFCIIPALRGDLDSRPAGSVLDEAKRLVESGVQEILVVSQDTSAYGKDKGGRTDFWN
GMPVKQDITSLARQLGKMGAWVRLHYIYPYPWVDDLIPLMAEGLILPYLDIPMQHASPRI
LKMMKRPGRVDRQLEAIQRWREICPDLVIRSTFIVGFPGETEEDFEMLLDFLREARLDRV
GCFKYSEVEGAVANTIAELISEDVKEDRYHRFMEVQAEISAERLARFVGRTMDILIDDVD
EEGAIGRSFADAPEIDGMVFINGETELEPGMLVRAVITHSDEHDLWAELVDADAEDDIEA