Protein Info for Shewana3_3619 in Shewanella sp. ANA-3

Annotation: molybdopterin oxidoreductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 764 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF10518: TAT_signal" amino acids 7 to 27 (21 residues), 26.3 bits, see alignment (E = 1e-09) TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 8 to 32 (25 residues), 19 bits, see alignment (E = 7e-08) PF04879: Molybdop_Fe4S4" amino acids 50 to 99 (50 residues), 41.7 bits, see alignment 1.8e-14 PF00384: Molybdopterin" amino acids 103 to 529 (427 residues), 214 bits, see alignment E=6.6e-67 PF01568: Molydop_binding" amino acids 643 to 753 (111 residues), 66.6 bits, see alignment E=3.9e-22

Best Hits

Swiss-Prot: 58% identical to PHSA_SALTY: Thiosulfate reductase molybdopterin-containing subunit PhsA (phsA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08352, thiosulfate reductase [EC: 1.-.-.-] (inferred from 100% identity to shn:Shewana3_3619)

MetaCyc: 58% identical to thiosulfate reductase (quinone) alpha subunit (Salmonella enterica enterica serovar Typhimurium)
RXN-18001 [EC: 1.8.5.5]

Predicted SEED Role

"polysulfide reductase, subunit A" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.8.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1C2 at UniProt or InterPro

Protein Sequence (764 amino acids)

>Shewana3_3619 molybdopterin oxidoreductase (RefSeq) (Shewanella sp. ANA-3)
MEVTMIELNRRTFLKGAGASGATCALASLLPGSLAALESKQLKGMGKDIASICEMCSTRC
PISARVIEGKNVFISGNKAAKSFGGKVCARGGAGHSLLYDPQRIVKPLKRVGERGEGKWA
EISWDEAYQLIADNLNKIKQAYGPEAVAFSSKSGSQEKHLFHLATAFGSPNTFTHASTCP
GGYEIAAKAMFGTKVKRDLSNSKYIINFGHNLYEGINMSETRGMMAAQMDKGAKLVVFEP
RFSIVADKADEWYAIRPGTDVAVALALCHVLIEDNLYDKAFIERYVEGFDAFAAEVKAYT
PEWAETVSDVPAKDIRRIAHEYAAKAPHAVVDFGHRATFTTEEFEMRRALYAANILIGNI
ERKGGIYLGQKPGDYNKLAGESVAPVLGKPGVKDMPKSAAKRIDQVEEQYAMMWSSGGVY
QTILDATLSAVPYQLHGWVMSRTNPMQTMTDRARVVEALKKLDFVAVCDVYISETAAYAD
VILPESTYLERDEEIADKSGKNPAYYVRQRVVETLGDTKPSWQIFKDIGHKLGLSEFYPW
DNMETLQLLQVNRDTALLRRIKDEGFVSFGKPIMLREPKMVAEFTKAYANAKPVDEDGTY
GSLLSFKTPSGKIELTSAKVEAMAPGRGVIKFREVHLKKADELYFIQGKVAVHTNGATHN
IPMLANLMSDNAIWVHPVTAGKLGISNGDPIRLTSSVGSEEGHALVTPGIRPDTVFAYMG
FGSKNKELVRATGKGIHCGNLLPHQTAPVCGMNIHTTGVTLAKR