Protein Info for Shewana3_3577 in Shewanella sp. ANA-3

Annotation: sodium/hydrogen exchanger (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 170 to 187 (18 residues), see Phobius details amino acids 199 to 215 (17 residues), see Phobius details amino acids 221 to 237 (17 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 336 to 360 (25 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 7 to 350 (344 residues), 158.9 bits, see alignment E=1.8e-50 PF02254: TrkA_N" amino acids 390 to 506 (117 residues), 67.3 bits, see alignment E=1.5e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3577)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L180 at UniProt or InterPro

Protein Sequence (547 amino acids)

>Shewana3_3577 sodium/hydrogen exchanger (RefSeq) (Shewanella sp. ANA-3)
MEPAILIITLICGMLVSRIGLPPLIGYLVAGFVLFVFGIEKESLPLLQELANLGVTLLLF
AIGLKLDIRSLFKAEVWAGSSIHLVLSMVLFIPILKIFGFIGLSQLDGLGIAQLSLIAFA
LSFSSTVFAIKVLEDKGDVQSLYGRVAIGILIMQDIFAVIFLTISKGAVPSVWALALLLL
PLAKPLIYKAFDRVGHGELLVLFGLVMALVVGAWLFESVGLKPDLGALIIGILLAGHKKA
SELAKSLFYFKELFLVAFFLTIGLNGLPTVSDVVLAALLVLLVPLKILLFVYLLTRFKLR
SRTSMLASFNLGNFSEFGLIVAAVATSKGWLPPQWLVIIAVALSFSFLFAAPLNTAVGNI
YQRFQQRLVRLEKPPLHPEDRPIAIGNPRFLILGMGRIGSGAYDELRARFDGEILGIEHK
QELVDLHRANGRNVVQGDASDTDFWEKLDRAPNLELVLLAMPHHAGNLFAVEQLKKLNYQ
GKLSAIVQYGDDAASLRSSGVHSVYNLYEAAGAGFVDHVVHELLPDSETKADAEAQEETQ
KQGSALA