Protein Info for Shewana3_3560 in Shewanella sp. ANA-3

Annotation: radical SAM domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 TIGR03942: anaerobic sulfatase maturase" amino acids 35 to 423 (389 residues), 506.9 bits, see alignment E=3.1e-156 PF04055: Radical_SAM" amino acids 44 to 211 (168 residues), 64.3 bits, see alignment E=1.6e-21 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 317 to 406 (90 residues), 64.7 bits, see alignment E=8e-22 PF13186: SPASM" amino acids 318 to 378 (61 residues), 35.2 bits, see alignment E=1.2e-12

Best Hits

KEGG orthology group: K06871, (no description) (inferred from 100% identity to shn:Shewana3_3560)

Predicted SEED Role

"Putative arylsulfatase regulatory protein" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L164 at UniProt or InterPro

Protein Sequence (435 amino acids)

>Shewana3_3560 radical SAM domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MTKTSMRASTILDVVPLKSAAKALGEHPDYQRRFHVMAKPGGAKCNIDCQYCFYLHKEGL
LHQPKQPEMDDATLEAYVKGYIESQDGDEIVFSWQGGEPTLLGVDYFRKVVQLQKKYRPL
GVNIENDLQTNGILLNDEWCQFLAEHNFLVGLSIDGPEELHNKYRVTRSGKPTFHLVMAA
VEKLKQYKVRFNALVTVNRHNVKYPLEVYRFVTKELGATYIQFNPVVEPSDFKTTAPQFW
NSSMIPTVGSELAKPGHPMSVVTDWSVDADDWGKFLIVTFEEWINNDLGRVLVNLFETAV
AQVMGKPAQLCITAEFCGKGLAIEHNGDVFSCDHYVYPEYKIANVHERPLNEMAFSTRQL
TFGLAKRDSLPQYCKDCPYLKLCWGECPKNRLLKTPDGEEGLNYLCPGIKAFFDYSLPIL
TGLAVLLGQPHGTNG