Protein Info for Shewana3_3544 in Shewanella sp. ANA-3

Annotation: cold-shock DNA-binding protein family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 transmembrane" amino acids 89 to 108 (20 residues), see Phobius details PF00313: CSD" amino acids 4 to 63 (60 residues), 39.7 bits, see alignment E=3.7e-14 PF05901: Excalibur" amino acids 152 to 185 (34 residues), 43.8 bits, see alignment 2.6e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3544)

Predicted SEED Role

"Cold shock domain family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L148 at UniProt or InterPro

Protein Sequence (192 amino acids)

>Shewana3_3544 cold-shock DNA-binding protein family protein (RefSeq) (Shewanella sp. ANA-3)
MERGILVRWNDEKGFGFIQPEQQGKDVFIHITVLKHMARKPQVGDSILYRTEIQNDGKVK
AIKASIEGVAVLANTSKSPRRNANPPSRSLSNTLLPLLLIFGIGIFGFKKYTEYEIAQAP
NNTEIETTPLYEPQTQFQSAPQAQFRCEAGKTHCSHMRSCAEATFYINNCPNTQMDGDGD
GIPCERQWCNGY