Protein Info for Shewana3_3505 in Shewanella sp. ANA-3
Annotation: cell division protein ZapA (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 43% identical to ZAPA_ERWT9: Cell division protein ZapA (zapA) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
KEGG orthology group: K09888, cell division protein ZapA (inferred from 94% identity to sbn:Sbal195_3805)Predicted SEED Role
"Z-ring-associated protein ZapA" in subsystem Bacterial Cytoskeleton
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0L109 at UniProt or InterPro
Protein Sequence (100 amino acids)
>Shewana3_3505 cell division protein ZapA (RefSeq) (Shewanella sp. ANA-3) MSNSAVEITLLGRTYSIACPKGQEDALRVVAQGVEQQLTTLKNRTNSLSREEIAIMAALN IGHELYQEKQKNKHYMKQMDDRISLLQSTLENALVERSTK