Protein Info for Shewana3_3486 in Shewanella sp. ANA-3

Annotation: alpha/beta hydrolase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF00135: COesterase" amino acids 64 to 171 (108 residues), 47.4 bits, see alignment E=3.1e-16 PF10340: Say1_Mug180" amino acids 66 to 196 (131 residues), 42.3 bits, see alignment E=9.1e-15 PF20434: BD-FAE" amino acids 68 to 169 (102 residues), 67.9 bits, see alignment E=1.9e-22 PF07859: Abhydrolase_3" amino acids 77 to 282 (206 residues), 233 bits, see alignment E=6.3e-73

Best Hits

KEGG orthology group: K01066, esterase / lipase [EC: 3.1.1.-] (inferred from 100% identity to shn:Shewana3_3486)

Predicted SEED Role

"FIG00543870: hypothetical protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-

Use Curated BLAST to search for 3.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0Z0 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Shewana3_3486 alpha/beta hydrolase domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MSQLYLEDGIKQLASEFIAAGCPSVREQSLEERRQGYIASTVLAGEPEAVFEVKTLSLEG
IELTLFKPSVDNNLPVVIYYHGGCFVSGGIATHNQQLRKIANDSGALVVAVSYRLAPEHV
YPAAHDDAFNAANLVQQHCQQWGGDDTNITLMGDSAGGHLALVTCLRLKAQGQWLPKKQV
LIYPMLDATAKSQSYIDNGDKYIITRDTLLTGFDMYLDWHPRTDVEASPLRSHDLAGLPE
THIITAEFDPLLDEGEQLFRNLLDAGVNAHCRRYLGVIHGFFQLAGVSQSARDAMVQITH
IIRV