Protein Info for Shewana3_3466 in Shewanella sp. ANA-3

Annotation: short-chain dehydrogenase/reductase SDR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF00106: adh_short" amino acids 37 to 228 (192 residues), 187 bits, see alignment E=4e-59 TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 37 to 292 (256 residues), 314.6 bits, see alignment E=2.2e-98 PF08659: KR" amino acids 40 to 192 (153 residues), 36.8 bits, see alignment E=5.9e-13 PF13561: adh_short_C2" amino acids 45 to 287 (243 residues), 193.4 bits, see alignment E=7e-61

Best Hits

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 100% identity to shn:Shewana3_3466)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0X0 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Shewana3_3466 short-chain dehydrogenase/reductase SDR (RefSeq) (Shewanella sp. ANA-3)
MCAPLCCVQGMGKDCDWILKHRETSNMAVEHSSLKGKVGLITGSTSGIGLATAHVLAEQG
CHLILHGLMPEAEGRRLAAEFAEQYHIHTYFSNADLRDPESIHAFMDAGVKALGSIDILV
NNAGIQHTENVAHFPIDKWNDIIAINLSSAFHTIQQAVPAMAEKRWGRIINIASVHGLVA
SVNKAAYCAAKHGIVGLTKVVAIECAEQGITVNAICPGWVDTPLINKQIEAIASNKGLSY
DEAKYQLVTAKQPLPEMLDPRQIGEFVLFLCSSAARGITGASLAMDGAWTAQ