Protein Info for Shewana3_3465 in Shewanella sp. ANA-3

Annotation: agmatine deiminase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 TIGR03380: agmatine deiminase" amino acids 13 to 367 (355 residues), 579.4 bits, see alignment E=1.2e-178 PF04371: PAD_porph" amino acids 21 to 367 (347 residues), 404 bits, see alignment E=2.4e-125

Best Hits

Swiss-Prot: 100% identical to AGUA_SHESA: Putative agmatine deiminase (aguA) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K10536, agmatine deiminase [EC: 3.5.3.12] (inferred from 100% identity to shn:Shewana3_3465)

MetaCyc: 53% identical to agmatine iminohydrolase (Arabidopsis thaliana col)
Agmatine deiminase. [EC: 3.5.3.12]

Predicted SEED Role

"Agmatine deiminase (EC 3.5.3.12)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0W9 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Shewana3_3465 agmatine deiminase (RefSeq) (Shewanella sp. ANA-3)
MTNANVDATQLTTKPSEDGFYMPAEWAAQQAVWMIWPYRPDNWRSAGAYAQATFAKVADA
IGGATPVYMGVPQAFLAEAQTVMPSHVTLVEIDSNDCWARDTGPTVVVNAEGECRGVDWG
FNAWGGHNGGLYFPWDKDEQVAAQMLKQHGFARYSAPLILEGGSIHVDGEGTCMTTAECL
LNANRNPDLTKEQIEALLRDYLNVKQFIWLEEGVYMDETDGHIDNMCCFARPGEVILHWT
DDETDPQYPRSKAALDVLQNTVDAQGRKLKIHLLPQPGPLYCTEEESKGVTEGTGVPRTA
GERLAGSYVNFLITNDRIVFPLLDPATDDIAAQKLQEIFPEHKIVGVPAREILLGGGNIH
CITQQIPSGK