Protein Info for Shewana3_3461 in Shewanella sp. ANA-3

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 48 to 70 (23 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 102 to 127 (26 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details amino acids 329 to 351 (23 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details PF07690: MFS_1" amino acids 16 to 344 (329 residues), 90.7 bits, see alignment E=9.5e-30 PF07672: MFS_Mycoplasma" amino acids 103 to 231 (129 residues), 32.1 bits, see alignment E=8.2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3461)

Predicted SEED Role

"HEXOSEPHOSPHATE TRANSPORT PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0W5 at UniProt or InterPro

Protein Sequence (391 amino acids)

>Shewana3_3461 major facilitator transporter (RefSeq) (Shewanella sp. ANA-3)
MPIKITHKYLVEGLVFTSYVLFAMAWVGGTASMNNIMASMHIESYASASLLSGAVTLAKI
VGTFAAAYLTLKFGVKYAFLVAALLIVTGIMTPFAPNYELLLVSRFLMGLGGAFMIVYFN
PIVMHWFAPEERPVINGLNAVAFNVGTAIVLWGMPSINAISGGWQQSLLVFSLASLVLAL
LWLLVKFEQAPSHQANAQQDNTHSYSYLDGLKDGFNWAYALTYSGLLSFYICLFTFYPQA
GISQSKWVIGFGIVGTIAGILYSRKQPLRLPIIRLSGLLIFLTVLGLSFGTAPWLQTLCA
IVLGFCIFLPVTALVSIPHELPKMTSQKITVIFSLFWSISYLISTLVLWLFGKLVDINQG
SYFASFVLITLLSATVFVGSYFLPETGQAKE