Protein Info for Shewana3_3456 in Shewanella sp. ANA-3

Annotation: RND family efflux transporter MFP subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 45 to 391 (347 residues), 167.3 bits, see alignment E=2.1e-53 PF25973: BSH_CzcB" amino acids 67 to 220 (154 residues), 43 bits, see alignment E=1.4e-14 PF25917: BSH_RND" amino acids 67 to 221 (155 residues), 67.5 bits, see alignment E=3e-22 PF25876: HH_MFP_RND" amino acids 114 to 190 (77 residues), 24.9 bits, see alignment E=8.2e-09 PF25944: Beta-barrel_RND" amino acids 228 to 317 (90 residues), 35.3 bits, see alignment E=5.2e-12 PF25990: Beta-barrel_YknX" amino acids 229 to 315 (87 residues), 31.1 bits, see alignment E=9.9e-11 PF25967: RND-MFP_C" amino acids 344 to 391 (48 residues), 27.7 bits, see alignment 8.4e-10

Best Hits

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 100% identity to shn:Shewana3_3456)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0W0 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Shewana3_3456 RND family efflux transporter MFP subunit (RefSeq) (Shewanella sp. ANA-3)
MDTQIQMKKSSKRKLILILSGLVLLGGGAYFLLHKPEAAPSYVTEPVKRGDIENSVLANG
MLQASKLVSVGAQVSGQIQSLPVDLGQEVKKGDLIAQIDSLAQQNNLQNALASLKSINAQ
YRAKQAQIRQAKLEYTRQQEMLADKASSRADFETAEATLTVYQAELEQLQAQKQQAEINV
DSARIDLGYTKITAPMDGTVVYSAVEVGQTVNANQTTPTIVEMAQLDTMTVKAQISEADI
VNVHPGQAVYFTILGRPNHPYRGTLRAIEPGPTSMDGDDSNMSSSDSDAIYYHGLFDVEN
PDRTLRIGMTAQISIVLAKADDALLVPSQVLRAKPRDKAASASDRQSRGPQYQVPVLVNN
QVQYVDVTVGINNKINAEILSGLNEGDQVVLGMPADGSTMKFRGPPMRF