Protein Info for Shewana3_3400 in Shewanella sp. ANA-3

Annotation: phosphoribulokinase/uridine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 72% identical to KPPR_ECOLI: Probable phosphoribulokinase (prkB) from Escherichia coli (strain K12)

KEGG orthology group: K00855, phosphoribulokinase [EC: 2.7.1.19] (inferred from 100% identity to son:SO_0878)

Predicted SEED Role

"Phosphoribulokinase (EC 2.7.1.19) homolog, function unknown" in subsystem Calvin-Benson cycle (EC 2.7.1.19)

MetaCyc Pathways

photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (21/26 steps found)
Rubisco shunt (9/10 steps found)
Calvin-Benson-Bassham cycle (11/13 steps found)
1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
ethene biosynthesis V (engineered) (19/25 steps found)
oxygenic photosynthesis (12/17 steps found)

KEGG Metabolic Maps

Carbon fixation in photosynthetic organisms

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0Q4 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Shewana3_3400 phosphoribulokinase/uridine kinase (RefSeq) (Shewanella sp. ANA-3)
MSAKHPIIAVTGSSGAGTTTTTTAFSHIFRQLGINAAFVEGDSFHHFTRAEMEVMIRKSQ
AENRNLSYFGPEANNFARLEQCFRDYGATGQGETRSYLHTFDEAVPFNQMPGTFTQWRPL
PENTDMLYYEGLHGGVVTGDANVAQHVDLLIGMVPIVNLEWIQKIIRDTSERGHSREKVM
GSIVRSMDDYIKHMTPQFSRTHINFQRVPTVDTSNPFSAKDIPSLDESFVVIRFRGINNV
DFPYYLSMIQGSFMSRVNTLVVPGGKMSLAMELILTPLIKDLMEKRQQLNSPQAN