Protein Info for Shewana3_3368 in Shewanella sp. ANA-3

Annotation: MarR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12802: MarR_2
  • amino acids 62 to 117 (56 residues), 39.3 bits, E=2.1e-13
• PF13463: HTH_27
  • amino acids 62 to 127 (66 residues), 29.5 bits, E=2.6e-10
• PF01047: MarR
  • amino acids 62 to 118 (57 residues), 44 bits, E=5.9e-15
• PF00583: Acetyltransf_1
  • amino acids 212 to 311 (100 residues), 66.1 bits, E=1.2e-21
• PF13673: Acetyltransf_10
  • amino acids 217 to 316 (100 residues), 35.3 bits, E=3.6e-12
• PF13302: Acetyltransf_3
  • amino acids 219 to 312 (94 residues), 26.9 bits, E=2.4e-09
• PF13508: Acetyltransf_7
  • amino acids 227 to 312 (86 residues), 55.5 bits, E=2.1e-18

Best Hits

KEGG orthology group: K03828, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to shn:Shewana3_3368)

Predicted SEED Role

"Transcriptional regulator, MarR family / Aspartate N-acetyltransferase (EC 2.3.1.17)" (EC 2.3.1.17)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.17

Sequence Analysis Tools

See A0L0M3 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Shewana3_3368 MarR family transcriptional regulator (RefSeq) (Shewanella sp. ANA-3)
MIRTEPQPAHTSACMAQLWLTLMAFNPTMANDPGSSSQLRHLSRYMVRHLGMLNAAFGDL
PLSPVQAHALFEIGNQPQTIKELACKLSIDKSNASRAIKHLVDKNLAQSQMHPRDNRCLV
VQLTPAGKKLLAKLDSQQNQLFQEILAQLTPEQIQQIEQALMQYNQAIHKAKQQSGYLIR
EATAADDAAIAQVIRAVSAEYGLTADKGYSVADPTLDCLSQIYSQPGAQYWVIEHEGQVV
GGAGIAPLANNEGICELQKMYFMPEIRGKGLAKRLALQALEFAREAGYQSCYLETTALLK
EALKLYEHLGFNYLSAPLGNTGHDACEIPMLLPLHAELNE