Protein Info for Shewana3_3367 in Shewanella sp. ANA-3

Annotation: NTPase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 TIGR00258: inosine/xanthosine triphosphatase" amino acids 10 to 178 (169 residues), 131.2 bits, see alignment E=2.1e-42 PF01931: NTPase_I-T" amino acids 11 to 173 (163 residues), 188.3 bits, see alignment E=4.4e-60

Best Hits

Swiss-Prot: 100% identical to NCPP_SHESA: Inosine/xanthosine triphosphatase (Shewana3_3367) from Shewanella sp. (strain ANA-3)

KEGG orthology group: None (inferred from 99% identity to she:Shewmr4_0759)

Predicted SEED Role

"Inosine/xanthosine triphosphatase (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0M2 at UniProt or InterPro

Protein Sequence (179 amino acids)

>Shewana3_3367 NTPase (RefSeq) (Shewanella sp. ANA-3)
MQQNIIKVIVGSKNPVKINAAANAMALLFPDYEIQTQGMDAPSGVPAQPMTDSDTRQGAI
NRVHYCQQQIEADYYFAMEGGVDCFEFGPATFAYIAIAHQARLSIGRGALLPLPMQVYQA
LEAGEELGHVMDRLFNTVNIKQKGGAIGLLTHGHATRESNYTQAIILAMAPFLNPELYP