Protein Info for Shewana3_3357 in Shewanella sp. ANA-3

Annotation: diguanylate phosphodiesterase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 144 to 170 (27 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 248 to 271 (24 residues), see Phobius details amino acids 290 to 314 (25 residues), see Phobius details PF02378: PTS_EIIC" amino acids 90 to 255 (166 residues), 49.1 bits, see alignment E=4.4e-17 PF00563: EAL" amino acids 372 to 593 (222 residues), 198.1 bits, see alignment E=1.6e-62

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3357)

Predicted SEED Role

"FOG: EAL domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L0L2 at UniProt or InterPro

Protein Sequence (610 amino acids)

>Shewana3_3357 diguanylate phosphodiesterase (RefSeq) (Shewanella sp. ANA-3)
MQLSKIFPLLALISLSFHFAKYLQLSAIVVCSLSLSILLAINAQDTGNVFNLDYVRAILA
DPRIAVLPIISAYLLRFLSAWKGLQLIKAKALSRYLKQHLNLFFPIVIGFIGLFAVVAEA
SIFLEWLFAPFIEGLQQASLGVQLFMRILLTHVLWCFGVHGDNAYLLLIGVDNGLMQLVP
HLTASQFMDLFILYGGSGATLSLIIAIFIGAKDSATRHIAKIATPFAIFNINEILIYGLP
IIFNPRLLVPFILSPLVNFILAYSAIHVGLLSFEGHSFPWITPPLLNAYIASGHMSAVFF
QVLLIGLGVLIYLPFVRRFSLMSEHYEFDSELIKRVQFQADIDRMTEQHYSQQQSESLKA
ELNLEKTIKEVLAGELQLHYQPKIALSTNHVVGYEALIRLKDEHGKLKGPYFIDAFQRAG
YSHIIDRFVINTVAEDLARWELEGFYPKVSINIDPNNITDPQLLATMNERLGSVANRVEI
EMLESAFMLDLNRIDNSMKQLKQHGFSFFLDDFGTGFSSLSLLSRINVDGIKLDRSILAN
TCEPKGRTLYLQICKLCNSLGFSLIAEGVETPEEAEFVNAAGVSYVQGWLYAKAMPGPEA
KAFWLERNSE